• • DRAMP ID

  • DRAMP01370

• • Peptide Name

  • Oh-defensin (O. hainana defensin; spiders, animals)

• • Source

  • Ornithoctonus hainana (Venoms)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • MLCKLSMFGAVLGVPACAIDCLPMGKTGGSCEGGVCGCRKLTFKILWDKKFG

• • Sequence Length

  • 52

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive bacteria: Staphylococcus aureus (MIC=1.25 µg/ml), Bacillus cereus (MIC=25 µg/ml);
    • Gram-negative bacteria: Escherichia coli (MIC=1.25 µg/ml), Bacillus dysenteriae (MIC=1.25 µg/ml), Pseudomonas aeruginosa (MIC=5 µg/ml).
    • Yeast: Candida albicans (MIC=1.25 µg/ml).

• • Hemolytic Activity

  • • [Ref.21538709] It has little hemolytic activity, inducing 7% hemolysis at the concentration up to 200 µg/ml (about 36 µM).

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Has three disulfide bonds

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP01370.

DRAMP01370

• • Function

  • Shows antibacterial and antifungal activities.

• ·Literature 1

• • Title

  • A defensin-like antimicrobial peptide from the venoms of spider, Ornithoctonus hainana.

• • Pubmed ID

  • 21538709

• • Reference

  • J Pept Sci. 2011 Jul;17(7):540-544.

• • Author

  • Zhao H, Kong Y, Wang H, Yan T, Feng F, Bian J, Yang Y, Yu H.