• DRAMP ID

    • DRAMP01387
    • Peptide Name

    • Odorranain-P2a (OdP2a; Frogs, amphibians, animals)
    • Source

    • Odorrana grahami (Yunnanfu frog) (Rana grahami)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKC
    • Sequence Length

    • 38
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.17272268] Gram-negative bacterium: Escherichia coli (MIC=6.25 μg/ml);
      • Gram-positive bacteria: Staphylococcus aureus (MIC=3.12 μg/ml), Bacillus subtilis (MIC=12.5 μg/ml).
      • Yeast: Candida albicans (MIC=3.12 μg/ml).
    • Hemolytic Activity

      • [Ref:17272268]Non-hemolytic activity against rabbit red blood cells
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01387 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C168H280N50O51S3
    • Absent Amino Acids

    • FMTW
    • Common Amino Acids

    • GL
    • Mass

    • 3912.56
    • PI

    • 8.64
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +4
    • Boman Index

    • -25.2
    • Hydrophobicity

    • 0.142
    • Aliphatic Index

    • 102.63
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1615
    • Absorbance 280nm

    • 43.65
    • Polar Residues

    • 16

DRAMP01387

DRAMP01387 chydropathy plot
    • Function

    • Odorranain-P2a exhibites antimicrobial activities against all of the tested microbes including Gram-positive and Gram-negative bacteria and fungi. Has no hemolytic activity against red cell.
  • ·Literature 1
    • Title

    • Anti-infection peptidomics of amphibian skin.
    • Reference

    • Mol Cell Proteomics. 2007 May;6(5):882-894.
    • Author

    • Li J, Xu X, Xu C, Zhou W, Zhang K, Yu H, Zhang Y, Zheng Y, Rees HH, Lai R, Yang D, Wu J.