General Information

    • DRAMP ID

    • DRAMP01454

    • Peptide Name

    • Esculentin-2JDa (Frogs, amphibians, animals)

    • Source

    • Odorrana jingdongensis (Jingdong frog) (Rana jingdongensis)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli (ATCC 25922) (MIC=34 µg/ml), Extended-spectrum ß-lactamases E. coli (ESBL) (MIC=34 µg/ml);
      • Gram-positive bacteria: Staphylococcus aureus (ATCC 25923) (MIC=8 µg/ml), Methicillin-resistant S. aureus (MRSA) (MIC=8 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys31 and Cys37)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01454 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C169H295N45O48S3

    • Absent Amino Acids

    • DHPRSWY

    • Common Amino Acids

    • K

    • Mass

    • 3821.65

    • PI

    • 9.51

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • -4.34

    • Hydrophobicity

    • 0.357

    • Aliphatic Index

    • 105.68

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 3.47

    • Polar Residues

    • 12

DRAMP01454

DRAMP01454 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against E. coli and S. aureus strains (Probable).

    • Tissue specificity

    • Expressed by the skin glands.

    • PTM

    • Contains one disulfide bond 31-37.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptides from the skin of the Asian frog, Odorrana jingdongensis: de novo sequencing and analysis of tandem mass spectrometry data.

    • Reference

    • J Proteomics. 2012 Oct 22;75(18):5807-5821.

    • Author

    • Liu J, Jiang J, Wu Z, Xie F.