• DRAMP ID

    • DRAMP01471
    • Peptide Name

    • Esculentin-1PLa (Frogs, amphibians, animals)
    • Source

    • Rana palustris (North American pickerel frog)
    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)
    • Gene

    • Not found
    • Sequence

    • GLFPKINKKKAKTGVFNIIKTVGKEAGMDLIRTGIDTIGCKIKGEC
    • Sequence Length

    • 46
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=1 µM);
      • Gram-positive bacterium: Staphylococcus aureus (MIC=12 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization (Cys40 and Cys46)
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys40 and Cys46.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01471 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C220H378N60O61S3
    • Absent Amino Acids

    • HQSWY
    • Common Amino Acids

    • K
    • Mass

    • 4935.97
    • PI

    • 9.76
    • Basic Residues

    • 10
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +6
    • Boman Index

    • -46.06
    • Hydrophobicity

    • -0.091
    • Aliphatic Index

    • 93.26
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 2.78
    • Polar Residues

    • 15

DRAMP01471

DRAMP01471 chydropathy plot
    • Function

    • Shows antibacterial against the Gram-positive bacterium S. aureus and the Gram-negative bacterium E. coli.
  • ·Literature 1
    • Title

    • Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris.
    • Reference

    • Biochim Biophys Acta. 2000 Nov 30;1543(1):95-105.
    • Author

    • Basir YJ, Knoop FC, Dulka J, Conlon JM.