• • DRAMP ID

  • DRAMP01484

• • Peptide Name

  • Esculentin-2ISa (Frogs, amphibians, animals)

• • Source

  • Odorrana ishikawae (Japanese Endangered frog)

• • Family

  • Belongs to the frog skin active peptide family (Brevinin subfamily)

• • Gene

  • Not found

• • Sequence

  • GIFSLIKGAAKLITKTVAKEAGKTGLELMACKVTNQC

• • Sequence Length

  • 37

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-negative bacterium: Escherichia coli (MC=12.5 µM);
    • Gram-positive bacteria: Staphylococcus aureus (MIC=3.1 µM), Staphylococcus aureus (MRSA) (MIC=25 µM), Bacillus subtilis (MIC=6.3 µM).
    • Yeast: Candida albicans (MIC=100 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Cyclization (Cys31 and Cys37)

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bond between Cys31 and Cys37.

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP01484.

DRAMP01484

• • Function

  • Shows antibacterial activity.

• ·Literature 1

• • Title

  • Identification and characterization of antimicrobial peptides from the skin of the endangered frog Odorrana ishikawae.

• • Pubmed ID

  • 21193000

• • Reference

  • Peptides. 2011 Apr;32(4):670-676.

• • Author

  • Iwakoshi-Ukena E, Ukena K, Okimoto A, Soga M, Okada G, Sano N, Fujii T, Sugawara Y, Sumida M.