• DRAMP ID

    • DRAMP01521
    • Peptide Name

    • Rugosin-B (Frogs, amphibians, animals)
    • Source

    • Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa)
    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)
    • Gene

    • Not found
    • Sequence

    • SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus 209P (MIC=6.25 µg/ml), Bacillus subtilis ATCC6633 (MIC=6.25 µg/ml), Micrococcus luteus ATCC9341 (MIC=1.56 µg/ml), Streptococcus pyogenes COOK (MIC=12.5 µg/ml);
      • Gram-negative bacteria: Escherichia coli NIHJ (MIC=12.5 µg/ml), Pseudomonas aeruginosa PAO-1 (MIC=100 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization (Cys27 and Cys33)
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys27 and Cys33.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01521 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C159H264N42O43S2
    • Absent Amino Acids

    • DHMPRTW
    • Common Amino Acids

    • K
    • Mass

    • 3516.22
    • PI

    • 9.7
    • Basic Residues

    • 6
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +5
    • Boman Index

    • -14.22
    • Hydrophobicity

    • 0.152
    • Aliphatic Index

    • 94.85
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1615
    • Absorbance 280nm

    • 50.47
    • Polar Residues

    • 10

DRAMP01521

DRAMP01521 chydropathy plot
    • Function

    • Shows antibacterial activity against both Gram-negative and Gram-positive bacteria.
    • Tissue specificity

    • Expressed by the skin glands.
    • PTM

    • Contains one disulfide bond 27-33.
  • ·Literature 1
    • Title

    • Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.
    • Reference

    • Biochem Biophys Res Commun. 1995 Jul 6;212(1):249-254.
    • Author

    • Suzuki S, Ohe Y, Kagegawa T, Tatemoto K.