General Information

    • DRAMP ID

    • DRAMP01548

    • Peptide Name

    • Caerin-1

    • Source

    • Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MEIKYLLTVFLVLLIVSDHCQAFLFSLIPSAISGLISAFKGRRKRDLNGQIDHFKNFRKRDAELEELLSKLPIY

    • Sequence Length

    • 74

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01548 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01548.

Physicochemical Information

    • Formula

    • C397H637N103O104S2

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • L

    • Mass

    • 8581.17

    • PI

    • 9.3

    • Basic Residues

    • 13

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 33

    • Net Charge

    • +5

    • Boman Index

    • -84.86

    • Hydrophobicity

    • 0.204

    • Aliphatic Index

    • 122.57

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 40.82

    • Polar Residues

    • 15

DRAMP01548

DRAMP01548 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Scorpion venom gland caerin-like antibacterial peptide gene: inducible expression and RNA editing.

    • Reference

    • Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Zhu S, Gao B.