• DRAMP ID

    • DRAMP01627
    • Peptide Name

    • Skin peptide tyrosine-tyrosine (Skin-PYY; SPYY; Frogs, amphibians, animals)
    • Source

    • Phyllomedusa bicolor (Two-colored leaf frog)
    • Family

    • Belongs to the NPY family
    • Gene

    • Not found
    • Sequence

    • YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY
    • Sequence Length

    • 36
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Aeromonas caviaeMIC=40 µg/ml
        Escherichia coli (MIC=10 µg/ml);-
      • Gram-positive bacteria:
        Target OrganismActivity
        Enterococcus faecalisMIC=10 µg/ml
        Nocardia brasiliensisMIC=20 µg/ml
      • Fungi: Cryptococcus neoformans (MIC=20 µg/ml), Candida albicans (MIC=15 µg/ml), Microsporum canis (MIC=10 µg/ml), Tricophyton rubrum (MIC=15 µg/ml), Arthroderma simii (MIC=10 µg/ml), Aspergillus fumigatus (MIC=80 µg/ml), Aspergillus niger (MIC>100 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Cell membrane
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Amidation
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01627 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01627.
    • Formula

    • C190H292N52O58S
    • Absent Amino Acids

    • CFW
    • Common Amino Acids

    • P
    • Mass

    • 4264.78
    • PI

    • 6.77
    • Basic Residues

    • 6
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +1
    • Boman Index

    • -97.17
    • Hydrophobicity

    • -1.208
    • Aliphatic Index

    • 56.94
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5960
    • Absorbance 280nm

    • 170.29
    • Polar Residues

    • 11

DRAMP01627

DRAMP01627 chydropathy plot
    • Function

    • Shows a broad spectrum of antibacterial activity against Gram-positive and Gram-negative bacteria, yeast and fungi.
    • Tissue specificity

    • Skin.
    • PTM

    • C-terminal amidation (By similarity).
  • ·Literature 1
    • Title

    • Skin peptide tyrosine-tyrosine, a member of the pancreatic polypeptide family: isolation, structure, synthesis, and endocrine activity.
    • Reference

    • Proc Natl Acad Sci U S A. 1994 Oct 25;91(22):10295-10299.
    • Author

    • Mor A, Chartrel N, Vaudry H, Nicolas P.
  • ·Literature 2
    • Title

    • Broad spectrum antibiotic activity of the skin-PYY.
    • Reference

    • FEBS Lett. 1996 Feb 19;380(3):237-240.
    • Author

    • Vouldoukis I, Shai Y, Nicolas P, Mor A.