• DRAMP ID

    • DRAMP01632
    • Peptide Name

    • Dermaseptin-S8 (Frogs, amphibians, animals)
    • Source

    • Phyllomedusa sauvagei (Sauvage's leaf frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ALWKTMLKKLGTVALHAGKAALGAAADTISQ
    • Sequence Length

    • 31
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Alpha helix
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01632 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01632.
    • Formula

    • C141H239N39O39S
    • Absent Amino Acids

    • CEFNPRY
    • Common Amino Acids

    • A
    • Mass

    • 3136.75
    • PI

    • 10
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +4
    • Boman Index

    • 3.31
    • Hydrophobicity

    • 0.426
    • Aliphatic Index

    • 110.65
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 183.33
    • Polar Residues

    • 7

DRAMP01632

DRAMP01632 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Identification of three novel Phyllomedusa sauvagei dermaseptins (sVI-sVIII) by cloning from a skin secretion-derived cDNA library.
    • Reference

    • Regul Pept. 2003 Nov 15;116(1-3):139-146.
    • Author

    • Chen T, Tang L, Shaw C.