• DRAMP ID

    • DRAMP01716
    • Peptide Name

    • OGF1 antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Odorrana grahami (Yunnanfu frog) (Rana grahami)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKSLLLLFFLGTINLSLCQDVTNAEEERRDEEVAKMEEIKRGLLRPPRCGEAYSMWT
    • Sequence Length

    • 61
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01716 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01716.
    • Formula

    • C315H510N84O93S5
    • Absent Amino Acids

    • H
    • Common Amino Acids

    • L
    • Mass

    • 7122.32
    • PI

    • 5.34
    • Basic Residues

    • 9
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 21
    • Net Charge

    • -1
    • Boman Index

    • -111.91
    • Hydrophobicity

    • -0.254
    • Aliphatic Index

    • 91.15
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7115
    • Absorbance 280nm

    • 118.58
    • Polar Residues

    • 15

DRAMP01716

DRAMP01716 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Odorrana grahmi antimicrobial peptide cDNA sequences.
    • Reference

    • Submitted (SEP-2007) to the EMBL/GenBank/DDBJ databases
    • Author

    • Wang X, Lai R.