General Information

    • DRAMP ID

    • DRAMP01756

    • Peptide Name

    • Temporin-2-RA2 peptide (Frogs, amphibians, animals)

    • Source

    • Odorrana andersonii (golden crossband frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTLKKSLLLLFFLGTNISLSLCEEERDADQEERRDDPEERDVEVEKRFLFPIASMLGKVLGK

    • Sequence Length

    • 65

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01756 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01756.

Physicochemical Information

    • Formula

    • C327H529N85O100S3

    • Absent Amino Acids

    • HWY

    • Common Amino Acids

    • L

    • Mass

    • 7347.49

    • PI

    • 4.73

    • Basic Residues

    • 10

    • Acidic Residues

    • 14

    • Hydrophobic Residues

    • 23

    • Net Charge

    • -4

    • Boman Index

    • -134.76

    • Hydrophobicity

    • -0.313

    • Aliphatic Index

    • 97.46

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 11

DRAMP01756

DRAMP01756 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • The highest antimicrobial peptides diversity, skin antimicrobial peptides peptidomics of Amphibian, Rana andersonii.

    • Reference

    • Submitted (OCT-2009) to the EMBL/GenBank/DDBJ databases

    • Author

    • Yang X, Liang X, Zhang Y, Lee WH.