• DRAMP ID

    • DRAMP01756
    • Peptide Name

    • Temporin-2-RA2 peptide (Frogs, amphibians, animals)
    • Source

    • Odorrana andersonii (golden crossband frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKSLLLLFFLGTNISLSLCEEERDADQEERRDDPEERDVEVEKRFLFPIASMLGKVLGK
    • Sequence Length

    • 65
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01756 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01756.
    • Formula

    • C327H529N85O100S3
    • Absent Amino Acids

    • HWY
    • Common Amino Acids

    • L
    • Mass

    • 7347.49
    • PI

    • 4.73
    • Basic Residues

    • 10
    • Acidic Residues

    • 14
    • Hydrophobic Residues

    • 23
    • Net Charge

    • -4
    • Boman Index

    • -134.76
    • Hydrophobicity

    • -0.313
    • Aliphatic Index

    • 97.46
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 11

DRAMP01756

DRAMP01756 chydropathy plot
    • Function

    • Amphibian defense peptide.
  • ·Literature 1
    • Title

    • The highest antimicrobial peptides diversity, skin antimicrobial peptides peptidomics of Amphibian, Rana andersonii.
    • Reference

    • Submitted (OCT-2009) to the EMBL/GenBank/DDBJ databases
    • Author

    • Yang X, Liang X, Zhang Y, Lee WH.