General Information

    • DRAMP ID

    • DRAMP02431

    • Peptide Name

    • Antimicrobial peptide microplusin (Ticks, Arthropods, animals)

    • Source

    • Ixodes scapularis (Black-legged tick) (Deer tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • HHVELCKKNDAELKEALTCITSKLPAALGCNDKSCVFEKLCKEGDLDEALKKHFTEAEVQTLHTTATDCDHSHGHEHSHGHEHGHGHH

    • Sequence Length

    • 88

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02431 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02431.

Physicochemical Information

    • Formula

    • C414H642N128O135S6

    • Absent Amino Acids

    • MRWY

    • Common Amino Acids

    • H

    • Mass

    • 9764.79

    • PI

    • 6.02

    • Basic Residues

    • 23

    • Acidic Residues

    • 16

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +7

    • Boman Index

    • -192.75

    • Hydrophobicity

    • -0.841

    • Aliphatic Index

    • 62.16

    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 4.31

    • Polar Residues

    • 25

DRAMP02431

DRAMP02431 chydropathy plot

Comments Information

    • Function

    • Has bacteriostatic activity against Gram-positive bacteria, but not against Gram-negative bacteria. Has fungistatic activity against some but not all fungi. Binds and sequesters copper and iron ions. Copper-chelating is crucial for antimicrobial activity against M. luteus.

    • PTM

    • Contains three disulfide bonds 6-41; 19-69; 30-35.

Literature Information

  • ·Literature 1

    • Title

    • Annotation of Ixodes scapularis.

    • Reference

    • Submitted (MAR-2008) to the EMBL/GenBank/DDBJ databases

    • Author

    • Caler E, Hannick L I, Bidwell S. et al.