• • DRAMP ID

  • DRAMP02462

• • Peptide Name

  • L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)

• • Source

  • Naja oxiana (Central Asian cobra) (Oxus cobra)

• • Family

  • Belongs to the flavin monoamine oxidase family (FIG1 subfamily)

• • Gene

  • Not found

• • Sequence

  • DDRRSPLEECFQQNDYEEFLEIARNSQLYQESLREDSSYHLSFIESLKSDALFSYEKKFWEADGIHGGKVINDLSLIHDLPKREIQALCYPSIKK

• • Sequence Length

  • 95

• • UniProt Entry

  • P0DI91

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic

• • Target Organism

  • • Gram-positive bacterium: Bacillus subtilis;
    • Gram-negative bacterium: E. coli.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02462.

DRAMP02462

• • Function

  • Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as antibacterial activity against both Gram-positive (B.subtilis) and Gram-negative (E.coli) bacteria, and inhibition of ADP- or collagen-induced platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, edema, apoptosis, and have antiparasitic activities.

• • Tissue specificity

  • Expressed by the venom gland.

• • Biophysicochemical properties

  • Kinetic parameters (KM=0.885 mM for L-Met; KM=0.051 mM for L-Phe; KM=0.147 mM for L-Trp; KM=0.75 mM for L-Leu)

• ·Literature 1

• • Title

  • L-Amino acid oxidase from Naja naja oxiana venom.

• • Pubmed ID

  • 18294891

• • Reference

  • Comp Biochem Physiol B Biochem Mol Biol. 2008 Apr;149(4):572-580.

• • Author

  • Samel M, Tõnismägi K, Rönnholm G, Vija H, Siigur J, Kalkkinen N, Siigur E.