General Information

    • DRAMP ID

    • DRAMP02530

    • Peptide Name

    • CRISPR-associated endoribonuclease Cas2 2 (Antiviral defensin)

    • Source

    • Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM9628 / NBRC 100126)

    • Family

    • Belongs to the CRISPR-associated endoribonuclease Cas2 prote

    • Gene

    • cas22

    • Sequence

    • MVVIVYVIVAYDVNVERVNRVKKFLRRYLNWVQNSLFEGELSSADLEEVKMGLREIINEDEDMVVIYRFRSADAFKREVMGIEKGLGGEEVI

    • Sequence Length

    • 92

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Metal-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02530 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02530.

Physicochemical Information

    • Formula

    • C481H770N128O141S4

    • Absent Amino Acids

    • CHPT

    • Common Amino Acids

    • V

    • Mass

    • 10730.42

    • PI

    • 4.87

    • Basic Residues

    • 13

    • Acidic Residues

    • 17

    • Hydrophobic Residues

    • 38

    • Net Charge

    • -4

    • Boman Index

    • -159.32

    • Hydrophobicity

    • -0.007

    • Aliphatic Index

    • 110.98

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11460

    • Absorbance 280nm

    • 125.93

    • Polar Residues

    • 19

DRAMP02530

DRAMP02530 chydropathy plot

Comments Information

    • Function

    • CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The complete genome sequence of the hyperthermophilic, sulphate-reducing archaeon Archaeoglobus fulgidus.

    • Reference

    • Nature. 1997 Nov 27;390(6658):364-370.

    • Author

    • Klenk HP, Clayton RA, Tomb JF, White O, Nelson KE, Ketchum KA, Dodson RJ, Gwinn M, Hickey EK, Peterson JD, Richardson DL, Kerlavage AR, Graham DE, Kyrpides NC, Fleischmann RD, Quackenbush J, Lee NH, Sutton GG, Gill S, Kirkness EF, Dougherty BA, McKenney K, Adams MD, Loftus B, et al.