General Information

    • DRAMP ID

    • DRAMP02773

    • Peptide Name

    • Pilosulin 5 (Myr b III; ants, insects, animals)

    • Source

    • Myrmecia banksi (Jack jumper ant) (Australian jumper ant)

    • Family

    • Not found

    • Gene

    • Myrb5

    • Sequence

    • DVKGMKKAIKGILDCVIEKGYDKLAAKLKKVIQQLWE

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02773 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02773.

Physicochemical Information

    • Formula

    • C192H327N49O51S2

    • Absent Amino Acids

    • FHNPRST

    • Common Amino Acids

    • K

    • Mass

    • 4202.13

    • PI

    • 9.47

    • Basic Residues

    • 9

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • -35.26

    • Hydrophobicity

    • -0.2

    • Aliphatic Index

    • 115.95

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 194.17

    • Polar Residues

    • 5

DRAMP02773

DRAMP02773 chydropathy plot

Comments Information

    • Function

    • Causes a significant and dose-dependent histamine release, probably by influencing the signal transduction of mast cells through a non-IgE-mediated pathway. This peptide does not have cytotoxic activities.

    • Subunit structure

    • Homodimer; disulfide-linked.

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains one disulfide bond.

Literature Information

  • ·Literature 1

    • Title

    • Pilosulin 5, a novel histamine-releasing peptide of the Australian ant, Myrmecia pilosula (Jack Jumper Ant).

    • Reference

    • Arch Biochem Biophys. 2008 Sep 15;477(2):411-416.

    • Author

    • Inagaki H, Akagi M, Imai HT, Taylor RW, Wiese MD, Davies NW, Kubo T.
  • ·Literature 2

    • Title

    • Proteomic analysis of Myrmecia pilosula (jack jumper) ant venom.

    • Reference

    • Toxicon. 2006 Feb;47(2):208-217.

    • Author

    • Wiese MD, Chataway TK, Davies NW, Milne RW, Brown SG, Gai WP, Heddle RJ.