General Information

    • DRAMP ID

    • DRAMP02775

    • Peptide Name

    • Antimicrobial peptide Alo-2 (Alo-2; knottin-type peptide; Insects, animals)

    • Source

    • Acrocinus longimanus (Giant harlequin beetle)

    • Family

    • Belongs to the AMP family

    • Gene

    • Not found

    • Sequence

    • CIANRNGCQPDGSQGNCCSGYCHKEPGWVAGYCR

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Candida glabrata patient 1 (MIC>64 µg/mL), C. albicans IHEM 8060 (MIC>64 µg/mL).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02775 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02775.

Physicochemical Information

    • Formula

    • C147H221N49O48S6

    • Absent Amino Acids

    • FLMT

    • Common Amino Acids

    • CG

    • Mass

    • 3635.03

    • PI

    • 7.78

    • Basic Residues

    • 4

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +2

    • Boman Index

    • -65.43

    • Hydrophobicity

    • -0.706

    • Aliphatic Index

    • 25.88

    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 268.33

    • Polar Residues

    • 19

DRAMP02775

DRAMP02775 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity against C. glabrata.

    • Domain

    • The presence of a disulfide through disulfide knot' structurally defines this protein as a knottin.

    • PTM

    • Contains three disulfide bonds 1-18; 8-22; 17-33.

Literature Information

  • ·Literature 1

    • Title

    • Solution structure of Alo-3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus.

    • Reference

    • Biochemistry. 2003 Dec 16;42(49):14434-14442.

    • Author

    • Barbault F, Landon C, Guenneugues M, Meyer JP, Schott V, Dimarcq JL, Vovelle F.