General Information

    • DRAMP ID

    • DRAMP02781

    • Peptide Name

    • Coleoptericin (Insects, animals)

    • Source

    • Zophobas atratus (Giant mealworm beetle)

    • Family

    • Belongs to the coleoptericin family

    • Gene

    • Not found

    • Sequence

    • SLQGGAPNFPQPSQQNGGWQVSPDLGRDDKGNTRGQIEIQNKGKDHDFNAGWGKVIRGPNKAKPTWHVGGTYRR

    • Sequence Length

    • 74

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli D31, E. coli D22 (highly activity), Acinetobacter baumannii, Pseudomonas maltophilia (lower activity);
      • Gram-positive bacterium: Micrococcus luteus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02781 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02781.

Physicochemical Information

    • Formula

    • C353H543N115O107

    • Absent Amino Acids

    • CM

    • Common Amino Acids

    • G

    • Mass

    • 8109.9

    • PI

    • 10.11

    • Basic Residues

    • 13

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +7

    • Boman Index

    • -196.98

    • Hydrophobicity

    • -1.316

    • Aliphatic Index

    • 42.16

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17990

    • Absorbance 280nm

    • 246.44

    • Polar Residues

    • 26

DRAMP02781

DRAMP02781 chydropathy plot

Comments Information

    • Function

    • Responsible for the anti Gram-negative activity of immune hemolymph of Z. atratus.

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity. Isolation from a coleopteran insect of a novel inducible antibacterial peptide and of new members of the insect defensin family.

    • Reference

    • J Biol Chem. 1991 Dec 25;266(36):24520-24525.

    • Author

    • Bulet P, Cociancich S, Dimarcq JL, Lambert J, Reichhart JM, Hoffmann D, Hetru C, Hoffmann JA.