• DRAMP ID

    • DRAMP02785
    • Peptide Name

    • Acaloleptin-A2 (chain of Acaloleptin A; Insects, animals)
    • Source

    • Acalolepta luxuriosa (Udo longhorn beetle)
    • Family

    • Belongs to the coleoptericin family
    • Gene

    • Not found
    • Sequence

    • SLQPGAPNINNKDQPWQVSPHISRDDNGNTRTNINVQRHGENNDFEAGWSKVVRGPNKAKPTWHIGGTHRW
    • Sequence Length

    • 71
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Aeromonas hydrophila, Erwinia persicinus, Serratia marcescens, Aeromonas hydrophila.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02785 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02785.
    • Formula

    • C348H530N116O106
    • Absent Amino Acids

    • CMY
    • Common Amino Acids

    • N
    • Mass

    • 8034.75
    • PI

    • 9.98
    • Basic Residues

    • 13
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +7
    • Boman Index

    • -211.31
    • Hydrophobicity

    • -1.354
    • Aliphatic Index

    • 48.03
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 22000
    • Absorbance 280nm

    • 314.29
    • Polar Residues

    • 25

DRAMP02785

DRAMP02785 chydropathy plot
    • Function

    • Acaloleptins A2 show antibacterial activity against Gram-negative bacteria but not against Gram-positive bacteria.
    • Induction

    • By bacterial infection. Expression detected 2 hours post-injection, with expression increasing until 48 hours post-injection and remaining considerably high at least until 72 hours post-injection.
  • ·Literature 1
    • Title

    • Acaloleptins A: inducible antibacterial peptides from larvae of the beetle, Acalolepta luxuriosa.
    • Reference

    • Arch Insect Biochem Physiol. 1999;40(2):88-98.
    • Author

    • Imamura M, Wada S, Koizumi N, Kadotani T, Yaoi K, Sato R, Iwahana H.
  • ·Literature 2
    • Title

    • Multipeptide precursor structure of acaloleptin A isoforms, antibacterial peptides from the Udo longicorn beetle, Acalolepta luxuriosa.
    • Reference

    • Dev Comp Immunol. 2009 Oct;33(10):1120-1127.
    • Author

    • Imamura M, Wada S, Ueda K, Saito A, Koizumi N, Iwahana H, Sato R.