General Information

    • DRAMP ID

    • DRAMP02796

    • Peptide Name

    • Defensin (Type 1 invertebrate defensin; Insects, animals)

    • Source

    • Pyrrhocoris apterus (Sap sucking bug)

    • Family

    • Belongs to the invertebrate defensin family (Type 1 subfamily)

    • Gene

    • Not found

    • Sequence

    • ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Micrococcus luteus, Bacillus megaterium, Aerococcus viridans, Staphylococcus aureus, S. saprophyticus, Pediococcus acidilactici, Bacillus subtilis QB935, Escherichia coli D22.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02796 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02796.

Physicochemical Information

    • Formula

    • C203H323N63O56S6

    • Absent Amino Acids

    • EM

    • Common Amino Acids

    • C

    • Mass

    • 4734.55

    • PI

    • 8.92

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +7

    • Boman Index

    • -48.2

    • Hydrophobicity

    • 0

    • Aliphatic Index

    • 72.56

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 175.36

    • Polar Residues

    • 17

DRAMP02796

DRAMP02796 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against Gram-positive bacteria and the Gram-negative bacterium E.coli D22.

    • PTM

    • Contains three disulfide bonds 3-34; 20-39; 24-41 (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Novel inducible antibacterial peptides from a hemipteran insect, the sap-sucking bug Pyrrhocoris apterus.

    • Reference

    • Biochem J. 1994 Jun 1;300 (Pt 2):567-575.

    • Author

    • Cociancich S, Dupont A, Hegy G, Lanot R, Holder F, Hetru C, Hoffmann JA, Bulet P.