General Information

    • DRAMP ID

    • DRAMP02797

    • Peptide Name

    • Beta-defensin 103A (Defensin, beta 103; Defensin, beta 103A; houses, mammals, animals)

    • Source

    • Equus caballus (Horse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB103A

    • Sequence

    • GIINMLQKSYCKIRKGRCALLGCLPKEEQIGSCSVSGRKCCRKKK

    • Sequence Length

    • 45

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02797 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02797.

Physicochemical Information

    • Formula

    • C211H374N68O58S7

    • Absent Amino Acids

    • DFHTW

    • Common Amino Acids

    • K

    • Mass

    • 5016.13

    • PI

    • 9.85

    • Basic Residues

    • 12

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +10

    • Boman Index

    • -89.22

    • Hydrophobicity

    • -0.416

    • Aliphatic Index

    • 78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 42.39

    • Polar Residues

    • 17

DRAMP02797

DRAMP02797 chydropathy plot

Comments Information

    • Function

    • Exhibits antimicrobial activity against Gram-positive and Gram-negative bacteria (By similarity).

    • PTM

    • Contains three disulfide bonds 11-40; 18-33; 23-41.

Literature Information

  • ·Literature 1

    • Title

    • Sequence analysis of a 212 kb defensin gene cluster on ECA 27q17.

    • Reference

    • Gene. 2006 Jul 19;376(2):192-198.

    • Author

    • Looft C, Paul S, Philipp U, Regenhard P, Kuiper H, Distl O, Chowdhary BP, Leeb T.