General Information

    • DRAMP ID

    • DRAMP02798

    • Peptide Name

    • Antimicrobial peptide NK-lysin (houses, mammals, animals)

    • Source

    • Equus caballus (Horse)

    • Family

    • Not found

    • Gene

    • NKL

    • Sequence

    • GIACWSCRKILQKLEDLVGEQPNEATINEAASRVCRNLGLLRGACKKIMRTCLRLISRDILAGKKPQEVCVDIKLCKH

    • Sequence Length

    • 78

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02798 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02798.

Physicochemical Information

    • Formula

    • C374H646N116O106S8

    • Absent Amino Acids

    • FY

    • Common Amino Acids

    • L

    • Mass

    • 8720.44

    • PI

    • 9.3

    • Basic Residues

    • 16

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +8

    • Boman Index

    • -136.59

    • Hydrophobicity

    • -0.106

    • Aliphatic Index

    • 107.56

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 76.3

    • Polar Residues

    • 20

DRAMP02798

DRAMP02798 chydropathy plot

Comments Information

    • Function

    • May be an effector molecule of cytotoxic activity. Has antimicrobial activity.

    • PTM

    • Contains three disulfide bonds 4-76; 7-70; 35-45.

Literature Information

  • ·Literature 1

    • Title

    • cDNA sequence of equine NK-lysin.

    • Reference

    • Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases

    • Author

    • Davis E.G, Zhang G, Sang Y, Rush B.R, Ross C, Blecha F.