• DRAMP ID

    • DRAMP02798
    • Peptide Name

    • Antimicrobial peptide NK-lysin (houses, mammals, animals)
    • Source

    • Equus caballus (Horse)
    • Family

    • Not found
    • Gene

    • NKL
    • Sequence

    • GIACWSCRKILQKLEDLVGEQPNEATINEAASRVCRNLGLLRGACKKIMRTCLRLISRDILAGKKPQEVCVDIKLCKH
    • Sequence Length

    • 78
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02798 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02798.
    • Formula

    • C374H646N116O106S8
    • Absent Amino Acids

    • FY
    • Common Amino Acids

    • L
    • Mass

    • 8720.44
    • PI

    • 9.3
    • Basic Residues

    • 16
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 28
    • Net Charge

    • +8
    • Boman Index

    • -136.59
    • Hydrophobicity

    • -0.106
    • Aliphatic Index

    • 107.56
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 76.3
    • Polar Residues

    • 20

DRAMP02798

DRAMP02798 chydropathy plot
    • Function

    • May be an effector molecule of cytotoxic activity. Has antimicrobial activity.
    • PTM

    • Contains three disulfide bonds 4-76; 7-70; 35-45.
  • ·Literature 1
    • Title

    • cDNA sequence of equine NK-lysin.
    • Reference

    • Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    • Author

    • Davis E.G, Zhang G, Sang Y, Rush B.R, Ross C, Blecha F.