General Information

    • DRAMP ID

    • DRAMP02808

    • Peptide Name

    • Myticin-A (Myt A; Cys-rich; molluscas, animals)

    • Source

    • Mytilus galloprovincialis (Mediterranean mussel)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Micrococcus luteus (MBC=2.25-4.5 µM), Bacillus megaterium (MBC=2.25-4.5 µM), Aerococcus viridans (MBC=9-4.5 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Rich

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02808 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02808.

Physicochemical Information

    • Formula

    • C187H283N59O50S9

    • Absent Amino Acids

    • DEINQ

    • Common Amino Acids

    • C

    • Mass

    • 4446.21

    • PI

    • 8.74

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +9

    • Boman Index

    • -41.76

    • Hydrophobicity

    • 0.043

    • Aliphatic Index

    • 41.5

    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 230.26

    • Polar Residues

    • 20

DRAMP02808

DRAMP02808 chydropathy plot

Comments Information

    • Function

    • Bacteriolytic activity against Gram-positive bacteria M. luteus, Bacillus megaterium and A. viridans.

    • PTM

    • contains four disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Myticin, a novel cysteine-rich antimicrobial peptide isolated from haemocytes and plasma of the mussel Mytilus galloprovincialis.

    • Reference

    • Eur J Biochem. 1999 Oct 1;265(1):71-78.

    • Author

    • Mitta G, Hubert F, Noël T, Roch P.