• DRAMP ID

    • DRAMP02808
    • Peptide Name

    • Myticin-A (Myt A; Cys-rich; molluscas, animals)
    • Source

    • Mytilus galloprovincialis (Mediterranean mussel)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR
    • Sequence Length

    • 40
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria: Micrococcus luteus (MBC=2.25-4.5 µM), Bacillus megaterium (MBC=2.25-4.5 µM), Aerococcus viridans (MBC=9-4.5 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Rich
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02808 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02808.
    • Formula

    • C187H283N59O50S9
    • Absent Amino Acids

    • DEINQ
    • Common Amino Acids

    • C
    • Mass

    • 4446.21
    • PI

    • 8.74
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +9
    • Boman Index

    • -41.76
    • Hydrophobicity

    • 0.043
    • Aliphatic Index

    • 41.5
    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 230.26
    • Polar Residues

    • 20

DRAMP02808

DRAMP02808 chydropathy plot
    • Function

    • Bacteriolytic activity against Gram-positive bacteria M. luteus, Bacillus megaterium and A. viridans.
    • PTM

    • contains four disulfide bonds.
  • ·Literature 1
    • Title

    • Myticin, a novel cysteine-rich antimicrobial peptide isolated from haemocytes and plasma of the mussel Mytilus galloprovincialis.
    • Reference

    • Eur J Biochem. 1999 Oct 1;265(1):71-78.
    • Author

    • Mitta G, Hubert F, Noël T, Roch P.