• DRAMP ID

    • DRAMP02810
    • Peptide Name

    • Myticin C
    • Source

    • Mytilus galloprovincialis (Mediterranean mussel)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
    • Sequence Length

    • 43
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02810 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02810.
    • Formula

    • C202H304N54O60S8
    • Absent Amino Acids

    • DMNW
    • Common Amino Acids

    • C
    • Mass

    • 4705.44
    • PI

    • 8.19
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +4
    • Boman Index

    • -25.85
    • Hydrophobicity

    • 0.179
    • Aliphatic Index

    • 59.07
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7950
    • Absorbance 280nm

    • 189.29
    • Polar Residues

    • 24

DRAMP02810

DRAMP02810 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • High sequence variability of myticin transcripts in hemocytes of immune-stimulated mussels suggests ancient host-pathogen interactions.
    • Reference

    • Dev Comp Immunol. 2008;32(3):213-226.
    • Author

    • Pallavicini A, Costa Mdel M, Gestal C, Dreos R, Figueras A, Venier P, Novoa B.