General Information

    • DRAMP ID

    • DRAMP02810

    • Peptide Name

    • Myticin C

    • Source

    • Mytilus galloprovincialis (Mediterranean mussel)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02810 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02810.

Physicochemical Information

    • Formula

    • C202H304N54O60S8

    • Absent Amino Acids

    • DMNW

    • Common Amino Acids

    • C

    • Mass

    • 4705.44

    • PI

    • 8.19

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -25.85

    • Hydrophobicity

    • 0.179

    • Aliphatic Index

    • 59.07

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7950

    • Absorbance 280nm

    • 189.29

    • Polar Residues

    • 24

DRAMP02810

DRAMP02810 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • High sequence variability of myticin transcripts in hemocytes of immune-stimulated mussels suggests ancient host-pathogen interactions.

    • Reference

    • Dev Comp Immunol. 2008;32(3):213-226.

    • Author

    • Pallavicini A, Costa Mdel M, Gestal C, Dreos R, Figueras A, Venier P, Novoa B.