General Information

    • DRAMP ID

    • DRAMP02821

    • Peptide Name

    • Holotricin-2 (Gly-rich; His-rich; invertebrate defensin; animals)

    • Source

    • Holotrichia diomphalia (Korean black chafer)

    • Family

    • Belongs to the coleoptericin family

    • Gene

    • Not found

    • Sequence

    • SLQPGAPSFPMPGSQLPTSVSGNVEKQGRNTIATIDAQHKTDRYDVRGTWTKVVDGPGRSKPNFRIGGSYRW

    • Sequence Length

    • 72

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02821 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02821.

Physicochemical Information

    • Formula

    • C344H539N105O105S

    • Absent Amino Acids

    • C

    • Common Amino Acids

    • G

    • Mass

    • 7857.76

    • PI

    • 10.27

    • Basic Residues

    • 11

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +6

    • Boman Index

    • -167.99

    • Hydrophobicity

    • -0.858

    • Aliphatic Index

    • 51.39

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 13980

    • Absorbance 280nm

    • 196.9

    • Polar Residues

    • 27

DRAMP02821

DRAMP02821 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against Gram-negative bacteria but not against Gram-positive bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Purification and molecular cloning of cDNA for an inducible antibacterial protein of larvae of a coleopteran insect, Holotrichia diomphalia.

    • Reference

    • J Biochem. 1994 Jan;115(1):82-86.

    • Author

    • Lee SY, Moon HJ, Kurata S, Kurama T, Natori S, Lee BL.