General Information

    • DRAMP ID

    • DRAMP02834

    • Peptide Name

    • Seminalplasmin (Calcium transport inhibitor; Peptide YY-2; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Not found

    • Gene

    • PYY2

    • Sequence

    • SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK

    • Sequence Length

    • 48

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-negative bacterium: Escherichia coli.
      • Fungi: Saccharomyces cerevisiae, Candida ablicans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Does not bind directly to calcium. It binds to calmodulin in the presence of Ca2+.

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02834 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02834.

Physicochemical Information

    • Formula

    • C245H395N77O70

    • Absent Amino Acids

    • CMQ

    • Common Amino Acids

    • KLS

    • Mass

    • 5539.31

    • PI

    • 10.36

    • Basic Residues

    • 13

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +8

    • Boman Index

    • -144.14

    • Hydrophobicity

    • -0.994

    • Aliphatic Index

    • 71.25

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 148.72

    • Polar Residues

    • 13

DRAMP02834

DRAMP02834 chydropathy plot

Comments Information

    • Function

    • Inhibits calcium transport into spermatozoa; it does not bind directly to calcium. Binds to calmodulin. Inhibits the growth of microorganisms. Seem to act as an antibiotic by permeabilizing the bacterial membrane.

Literature Information

  • ·Literature 1

    • Title

    • Amino acid sequence of seminalplasmin, an antimicrobial protein from bull semen.

    • Reference

    • EMBO J. 1983;2(7):1159-1163.

    • Author

    • Theil R, Scheit KH.
  • ·Literature 2

    • Title

    • Functional properties of peptides derived from seminalplasmin: binding to monospecific anti-seminalplasmin immunoglobulins G and calmodulin.

    • Reference

    • Biol Chem Hoppe Seyler. 1990 Feb;371(2):111-116.

    • Author

    • Krauhs E, Preuss KD, Scheit KH.
  • ·Literature 3

    • Title

    • The structure of caltrin, the calcium-transport inhibitor of bovine seminal plasma.

    • Reference

    • Proc Natl Acad Sci U S A. 1985 Oct;82(19):6490-6491.

    • Author

    • Lewis RV, Agustin JS, Kruggel W, Lardy HA.