General Information

    • DRAMP ID

    • DRAMP02850

    • Peptide Name

    • Casocidin-1 (mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the alpha-casein family

    • Gene

    • CSN1S2

    • Sequence

    • KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK

    • Sequence Length

    • 39

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Staphylococcus carnosus, Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02850 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP02850.

Physicochemical Information

    • Formula

    • C223H360N62O60

    • Absent Amino Acids

    • CDGMW

    • Common Amino Acids

    • K

    • Mass

    • 4869.69

    • PI

    • 10.08

    • Basic Residues

    • 11

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +8

    • Boman Index

    • -110.51

    • Hydrophobicity

    • -1.326

    • Aliphatic Index

    • 70

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 4470

    • Absorbance 280nm

    • 117.63

    • Polar Residues

    • 9

DRAMP02850

DRAMP02850 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Casocidin-I: a casein-alpha s2 derived peptide exhibits antibacterial activity.

    • Reference

    • FEBS Lett. 1995 Sep 25;372(2-3):185-188.

    • Author

    • Zucht HD, Raida M, Adermann K, Mägert HJ, Forssmann WG.