General Information

    • DRAMP ID

    • DRAMP02879

    • Peptide Name

    • Tracheal antimicrobial peptide (mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • NPVSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCR

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

      • Yeast: Candida ablicans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02879 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02879.

Physicochemical Information

    • Formula

    • C158H279N55O43S7

    • Absent Amino Acids

    • DEFHLWY

    • Common Amino Acids

    • C

    • Mass

    • 3861.72

    • PI

    • 9.7

    • Basic Residues

    • 7

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +7

    • Boman Index

    • -57.2

    • Hydrophobicity

    • 0.044

    • Aliphatic Index

    • 75.56

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 10.71

    • Polar Residues

    • 15

DRAMP02879

DRAMP02879 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Airway epithelial cells are the site of expression of a mammalian antimicrobial peptide gene.

    • Reference

    • Proc Natl Acad Sci U S A. 1993 May 15;90(10):4596-600.

    • Author

    • Diamond G, Jones DE, Bevins CL.