• DRAMP ID

    • DRAMP02985
    • Peptide Name

    • Neutrophil cationic peptide 2 (CP-2; GNCP-2; pigs, mammals, animals)
    • Source

    • Cavia porcellus (Guinea pig)
    • Family

    • Belongs to the alpha-defensin family
    • Gene

    • Not found
    • Sequence

    • RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC
    • Sequence Length

    • 31
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral
    • Target Organism

      • Gram-negative bacterium: Escherichia coli;
      • Gram-positive bacterium: Staphylococcus aureus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02985 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02985.
    • Formula

    • C164H262N54O41S6
    • Absent Amino Acids

    • ADEHKMSW
    • Common Amino Acids

    • R
    • Mass

    • 3838.58
    • PI

    • 9.8
    • Basic Residues

    • 7
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +7
    • Boman Index

    • -93.39
    • Hydrophobicity

    • -0.223
    • Aliphatic Index

    • 47.1
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 111.83
    • Polar Residues

    • 15

DRAMP02985

DRAMP02985 chydropathy plot
    • Function

    • Has antibiotic, anti-fungi and antiviral activity.
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Cloning and characterization of the guinea pig neutrophil cationic peptide-1 and -2 genes.
    • Reference

    • DNA Seq. 1993;4(2):123-128.
    • Author

    • Nagaoka I, Nonoguchi A, Yamashita T.
  • ·Literature 2
    • Title

    • Synergistic actions of antibacterial neutrophil defensins and cathelicidins.
    • Reference

    • Inflamm Res. 2000 Feb;49(2):73-79.
    • Author

    • Nagaoka I, Hirota S, Yomogida S, Ohwada A, Hirata M.