General Information

    • DRAMP ID

    • DRAMP02993

    • Peptide Name

    • Abaecin (Pro-rich; insects, arthropods, invertebrates, animals)

    • Source

    • Apis mellifera (Honeybee)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.2298215] Gram-negative bacteria: Agrobacterium tumefaciens Gembloux A (MIC=25-50 µg/ml), Erwinia salicis NCPPB 2530 (MIC=25-50 µg/ml), Escherichia coli NCTC 9001 (MIC=25-50 µg/ml), Escherichia coli K514 (MIC=10-25 µg/ml), Pseudomonas syringae pv.tomato NCPPB 1105 (MIC=25-50 µg/ml), Xanthomonas campestris pv. vesicatoria LMG 905 (MIC=5-10 µg/ml);
      • Gram-positive bacteria: Bacillus megateriurn QMB 1551 (MIC=10-25 µg/ml), Micrococcus lysodeikticus LMG 4050 (MIC=10-25 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Rich

    • Structure Description

    • The prolines are in repeated motifs.

    • Helical Wheel Diagram

    • DRAMP02993 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02993.

Physicochemical Information

    • Formula

    • C187H270N48O43

    • Absent Amino Acids

    • ACDEHMS

    • Common Amino Acids

    • P

    • Mass

    • 3878.5

    • PI

    • 10.45

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +4

    • Boman Index

    • -40.74

    • Hydrophobicity

    • -0.912

    • Aliphatic Index

    • 40

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 256.97

    • Polar Residues

    • 9

DRAMP02993

DRAMP02993 chydropathy plot

Comments Information

    • Function

    • This peptide has bactericidal activity.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of abaecin, a major antibacterial response peptide in the honeybee (Apis mellifera).

    • Reference

    • Eur J Biochem. 1990 Jan 26;187(2):381-386.

    • Author

    • Casteels P, Ampe C, Riviere L, Van Damme J, Elicone C, Fleming M, Jacobs F, Tempst P.
  • ·Literature 2

    • Title

    • Acute Transcriptional Response of the Honeybee Peptide-Antibiotics Gene Repertoire and Required Post-translational Conversion of the Precursor Structures.

    • Reference

    • J Biol Chem. 1994 Nov 18;269(46):28569-28575.

    • Author

    • Casteels-Josson K, Zhang W, Capaci T, Casteels P, Tempst P.