General Information

    • DRAMP ID

    • DRAMP03259

    • Peptide Name

    • VrCRP (Cyst-rich; Plant defensin)

    • Source

    • V. radiata (a bruchid-resistant mungbean)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC

    • Sequence Length

    • 46

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03259 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03259.

Physicochemical Information

    • Formula

    • C211H347N65O63S10

    • Absent Amino Acids

    • FPQ

    • Common Amino Acids

    • C

    • Mass

    • 5123.07

    • PI

    • 8.9

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +6

    • Boman Index

    • -77.87

    • Hydrophobicity

    • -0.283

    • Aliphatic Index

    • 50.87

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 199.56

    • Polar Residues

    • 24

DRAMP03259

DRAMP03259 chydropathy plot

Comments Information

    • Function

    • VrCRP exhibits insecticidal activity in vitro against C. chinensis.

Literature Information

  • ·Literature 1

    • Title

    • A novel defensin encoded by a mungbean cDNA exhibits insecticidal activity against bruchid.

    • Reference

    • J Agric Food Chem. 2002 Dec 4;50(25):7258-7263.

    • Author

    • Chen KC, Lin CY, Kuan CC, Sung HY, Chen CS.