• DRAMP ID

    • DRAMP03289
    • Peptide Name

    • Apl-AvBD16 (Beta defensins; Ducks, birds, animals)
    • Source

    • Anas platyrhynchos (Peking duck)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWG
    • Sequence Length

    • 50
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03289 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03289.
    • Formula

    • C242H372N78O60S6
    • Absent Amino Acids

    • DKMY
    • Common Amino Acids

    • G
    • Mass

    • 5526.46
    • PI

    • 9.3
    • Basic Residues

    • 9
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 18
    • Net Charge

    • +8
    • Boman Index

    • -60.42
    • Hydrophobicity

    • 0.242
    • Aliphatic Index

    • 72.2
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 119.9
    • Polar Residues

    • 19

DRAMP03289

DRAMP03289 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Ma D, Zhang K, Zhang M, Xin S, Liu X, Han Z, Shao Y, Liu S.
    • Reference

    • PLoS One. 2012;7(10):e47743.
    • Author

    • Ma D, Zhang K, Zhang M, Xin S, Liu X, Han Z, Shao Y, Liu S.