General Information

    • DRAMP ID

    • DRAMP03423

    • Peptide Name

    • BIN1b (Sperm-associated antigen 11; Antimicrobial-like protein Bin-1b; Rodents, mammals, animals)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Spag11

    • Sequence

    • DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR

    • Sequence Length

    • 49

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03423 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03423.

Physicochemical Information

    • Formula

    • C233H379N79O68S8

    • Absent Amino Acids

    • AY

    • Common Amino Acids

    • R

    • Mass

    • 5631.54

    • PI

    • 9.21

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -141.09

    • Hydrophobicity

    • -0.569

    • Aliphatic Index

    • 51.63

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 122.4

    • Polar Residues

    • 19

DRAMP03423

DRAMP03423 chydropathy plot

Comments Information

    • Function

    • Antimicrobial peptide against E.coli. Is also responsible for sperm maturation, storage, and protection.

    • Tissue specificity

    • Only expressed in epididymis (middle part of the caput).

    • Developmental stage

    • Its expression starts at 30 days of age, reaches a maximum during the sexually mature period, and then decreased in old rats.

    • PTM

    • Contains three disulfide bonds 11-40; 18-33; 23-41.

Literature Information

  • ·Literature 1

    • Title

    • Recombinant expression and characterization of an epididymis-specific antimicrobial peptide BIN1b/SPAG11E.

    • Reference

    • J Biotechnol. 2009 Jan 1;139(1):33-37

    • Author

    • Guo C, Diao H, Lian Y, Yu H, Gao H, Zhang Y, Lin D.