• DRAMP ID

    • DRAMP03426
    • Peptide Name

    • Beta-defensin 4 (BD-4, RBD-4; Defensin, beta 4; RBD-2; Rodents, mammals, animals)
    • Source

    • Rattus norvegicus (Rat)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb4
    • Sequence

    • QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
    • Sequence Length

    • 41
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C186H311N59O51S6
    • Absent Amino Acids

    • ADEHMY
    • Common Amino Acids

    • G
    • Mass

    • 4382.24
    • PI

    • 9.61
    • Basic Residues

    • 7
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +7
    • Boman Index

    • -52.75
    • Hydrophobicity

    • -0.193
    • Aliphatic Index

    • 61.71
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 146.88
    • Polar Residues

    • 20

DRAMP03426

    • Function Has antibacterial activity (By similarity).

    • PTM

    • Contains three disulfide bonds 9-37; 16-30; 20-38.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.