• DRAMP ID

    • DRAMP03432
    • Peptide Name

    • Beta-defensin 13 (BD-13, RBD-13; Defensin, beta 13; Rodents, mammals, animals)
    • Source

    • Rattus norvegicus (Rat)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb13
    • Sequence

    • TLYRRFLCKKMKGRCETACLSFEKKIGTCRADLTPLCCKEKKKH
    • Sequence Length

    • 44
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03432 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03432.
    • Formula

    • C223H379N67O59S7
    • Absent Amino Acids

    • NQVW
    • Common Amino Acids

    • K
    • Mass

    • 5167.3
    • PI

    • 9.65
    • Basic Residues

    • 14
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +10
    • Boman Index

    • -106.25
    • Hydrophobicity

    • -0.636
    • Aliphatic Index

    • 57.73
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 43.37
    • Polar Residues

    • 14

DRAMP03432

DRAMP03432 chydropathy plot
    • Function Has antibacterial activity (By similarity).

    • PTM

    • Contains three disulfide bonds 8-37; 15-29; 19-38.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.