• DRAMP ID

    • DRAMP03434
    • Peptide Name

    • Beta-defensin 15 (BD-15, RBD-15; Defensin, beta 15; Rodents, mammals, animals)
    • Source

    • Rattus norvegicus (Rat)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb15
    • Sequence

    • FFDEKCSRINGRCTESCLKNEELIALCQKNLKCCVTVQPCGRDKGDELDEDSGYNRTRG
    • Sequence Length

    • 59
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C275H449N85O95S7
    • Absent Amino Acids

    • HMW
    • Common Amino Acids

    • CE
    • Mass

    • 6690.52
    • PI

    • 5.31
    • Basic Residues

    • 10
    • Acidic Residues

    • 11
    • Hydrophobic Residues

    • 12
    • Net Charge

    • -1
    • Boman Index

    • -178.55
    • Hydrophobicity

    • -0.841
    • Aliphatic Index

    • 57.8
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 32.16
    • Polar Residues

    • 23

DRAMP03434

    • Function Has antibacterial activity (By similarity).

    • PTM

    • Contains three disulfide bonds 6-33; 13-27; 17-34.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.