• DRAMP ID

    • DRAMP03645
    • Peptide Name

    • fowlicidin-2
    • Source

    • Gallus gallus
    • Family

    • Not found
    • Gene

    • CATHL2
    • Sequence

    • LVQRGRFGRFLRKIRRFRPKVTITIQGSARFG
    • Sequence Length

    • 32
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.27698732] Gram-positive bacterium: Staphylococcus aureus ATCC 29213 (MIC=4µM);
      • Gram-negative bacterium: Escherichia coli ATCC 25922 (MIC=1µM), Pseudomonas aeruginosa ATCC 27853 (MIC=4µM), Salmonella typhimurium C77-31 (MIC=2µM)
    • Hemolytic Activity

      • [Ref.27698732] 15% hemolysis at 10µM,40% hemolysis at 80µM,60% hemolysis at 200µM against human red blood cells.
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not foundn
    • Helical Wheel Diagram

    • DRAMP03645 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP03645.
    • Formula

    • C173H290N60O38
    • Absent Amino Acids

    • CDEHMNWY
    • Common Amino Acids

    • R
    • Mass

    • 3818.58
    • PI

    • 12.85
    • Basic Residues

    • 10
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +10
    • Boman Index

    • -99.91
    • Hydrophobicity

    • -0.428
    • Aliphatic Index

    • 82.19
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 7

DRAMP03645

DRAMP03645 chydropathy plot
    • Function

    • Antibacterial activity against the Gram-negative bacteria and Gram-positive bacteria. Has hemolytic activity.
  • ·Literature 1
    • Title

    • Recombinant expression and biological characterization of the antimicrobial peptide fowlicidin-2 in Pichia pastoris.
    • Reference

    • Exp Ther Med. 2016 Oct;12(4):2324-2330.
    • Author

    • Xing LW, Tian SX, Gao W, Yang N, Qu P, Liu D, Jiao J, Wang J, Feng XJ.