General Information

    • DRAMP ID

    • DRAMP03813

    • Peptide Name

    • Pardaxin P-5 (Pardaxin P1a; Pardaxin Pa5)

    • Source

    • Pardachirus marmoratus (Finless sole) (Achirus marmoratus)

    • Family

    • Belongs to the pardaxin family

    • Gene

    • Not found

    • Sequence

    • GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03813 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03813.

Physicochemical Information

    • Formula

    • C156H250N36O47

    • Absent Amino Acids

    • CHMNRWY

    • Common Amino Acids

    • S

    • Mass

    • 3381.91

    • PI

    • 6.07

    • Basic Residues

    • 2

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • 0

    • Boman Index

    • 2.05

    • Hydrophobicity

    • 0.652

    • Aliphatic Index

    • 112.42

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 11

DRAMP03813

DRAMP03813 chydropathy plot

Comments Information

    • Function

    • Exhibits unusual shark repellent and surfactant properties. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.

    • Domain

    • Consists of a C-terminal hydrophilic region and a predominantly hydrophobic remainder.

Literature Information

  • ·Literature 1

    • Title

    • Isolation, characterization and synthesis of a novel paradaxin isoform.

    • Reference

    • FEBS Lett. 1998 Sep 18;435(2-3):173-177.

    • Author

    • Adermann K, Raida M, Paul Y, Abu-Raya S, Bloch-Shilderman E, Lazarovici P, Hochman J, Wellhöner H.