• DRAMP ID

    • DRAMP03813
    • Peptide Name

    • Pardaxin P-5 (Pardaxin P1a; Pardaxin Pa5)
    • Source

    • Pardachirus marmoratus (Finless sole) (Achirus marmoratus)
    • Family

    • Belongs to the pardaxin family
    • Gene

    • Not found
    • Sequence

    • GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • Biological Activity

    • Cytotoxic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Cell membrane
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03813 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03813.
    • Formula

    • C156H250N36O47
    • Absent Amino Acids

    • CHMNRWY
    • Common Amino Acids

    • S
    • Mass

    • 3381.91
    • PI

    • 6.07
    • Basic Residues

    • 2
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • 0
    • Boman Index

    • 2.05
    • Hydrophobicity

    • 0.652
    • Aliphatic Index

    • 112.42
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 11

DRAMP03813

DRAMP03813 chydropathy plot
    • Function

    • Exhibits unusual shark repellent and surfactant properties. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.
    • Domain

    • Consists of a C-terminal hydrophilic region and a predominantly hydrophobic remainder.
  • ·Literature 1
    • Title

    • Isolation, characterization and synthesis of a novel paradaxin isoform.
    • Reference

    • FEBS Lett. 1998 Sep 18;435(2-3):173-177.
    • Author

    • Adermann K, Raida M, Paul Y, Abu-Raya S, Bloch-Shilderman E, Lazarovici P, Hochman J, Wellhöner H.