• DRAMP ID

    • DRAMP04514
    • Peptide Name

    • Brevinin-2-AJ7 antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Amolops jingdongensis (Chinese torrent frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTMKKSLLVLFFLGTISLSLCEEERNADEDDGEMTEEEKRGLVSTFKQVGISAIKGAAKNVLDVLSCKIAKTC
    • Sequence Length

    • 74
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04514 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04514.
    • Formula

    • C355H589N91O113S6
    • Absent Amino Acids

    • HPWY
    • Common Amino Acids

    • LEK
    • Mass

    • 8132.48
    • PI

    • 5.05
    • Basic Residues

    • 10
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 27
    • Net Charge

    • -2
    • Boman Index

    • -94.95
    • Hydrophobicity

    • 0.049
    • Aliphatic Index

    • 94.86
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 1.71
    • Polar Residues

    • 21

DRAMP04514

DRAMP04514 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Anti-infection peptidomics of amphibian skin.
    • Reference

    • Mol Cell Proteomics. 2007 May;6(5):882-894.
    • Author

    • Li J, Xu X, Xu C, Zhou W, Zhang K, Yu H, Zhang Y, Zheng Y, Rees HH, Lai R, Yang D, Wu J.