General Information

    • DRAMP ID

    • DRAMP04518

    • Peptide Name

    • Odorranain-P1a antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Odorrana grahami (Yunnanfu frog) (Rana grahami)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTLKKSLLLLFFLGTINLFFCQEEERNADEEERRDERDVEVEKRVIPFVASVAAETMQHVYCAASKKMLKLNWKSSDVENHLAKC

    • Sequence Length

    • 86

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04518 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04518.

Physicochemical Information

    • Formula

    • C447H710N120O132S6

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • EL

    • Mass

    • 10069.64

    • PI

    • 5.68

    • Basic Residues

    • 15

    • Acidic Residues

    • 15

    • Hydrophobic Residues

    • 33

    • Net Charge

    • 0

    • Boman Index

    • -168.57

    • Hydrophobicity

    • -0.29

    • Aliphatic Index

    • 86.16

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 83.71

    • Polar Residues

    • 17

DRAMP04518

DRAMP04518 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Anti-infection peptidomics of amphibian skin.

    • Reference

    • Mol Cell Proteomics. 2007 May;6(5):882-894.

    • Author

    • Li J, Xu X, Xu C, Zhou W, Zhang K, Yu H, Zhang Y, Zheng Y, Rees HH, Lai R, Yang D, Wu J.