• DRAMP ID

    • DRAMP04521
    • Peptide Name

    • Esculentin-2MT2 antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Amolops mantzorum
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKSMLLLFFLGTISLSLCEEERSADEDDGEKEVKRGIFSLIKTAAKFVGKNLLKQAGKAGMEHLACKANNQC
    • Sequence Length

    • 76
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04521 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04521.
    • Formula

    • C370H609N99O110S6
    • Absent Amino Acids

    • PWY
    • Common Amino Acids

    • LK
    • Mass

    • 8396.86
    • PI

    • 8.5
    • Basic Residues

    • 13
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 28
    • Net Charge

    • +3
    • Boman Index

    • -98.48
    • Hydrophobicity

    • -0.115
    • Aliphatic Index

    • 88.68
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 1.67
    • Polar Residues

    • 20

DRAMP04521

DRAMP04521 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Antimicrobial peptides from amphibian skin of Amolops mantzorum.
    • Reference

    • Submitted (AUG-2010) to the EMBL/GenBank/DDBJ database
    • Author

    • Wang H, Liu J.