• DRAMP ID

    • DRAMP04526
    • Peptide Name

    • Parigidin-br1 (Cyclotides; Plants)
    • Source

    • Palicourea rigida (Rubiaceae)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SCVFIPCITSLAGCSCKNKVCYYDGGSVPCGE
    • Sequence Length

    • 32
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Insecticidal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04526 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C140H219N35O45S6
    • Absent Amino Acids

    • HMQRW
    • Common Amino Acids

    • C
    • Mass

    • 3304.85
    • PI

    • 5.78
    • Basic Residues

    • 2
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 8
    • Net Charge

    • 0
    • Boman Index

    • -6.61
    • Hydrophobicity

    • 0.481
    • Aliphatic Index

    • 66.88
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 108.23
    • Polar Residues

    • 18

DRAMP04526

DRAMP04526 chydropathy plot
    • Function

    • Parigidin-br1 showes potent insecticidal activity against neonate larvae of Lepidoptera (Diatraea saccharalis), causing 60% mortality at a concentration of 1 µm but had no detectable antibacterial effects.
  • ·Literature 1
    • Title

    • Identification and structural characterization of novel cyclotide with activity against an insect pest of sugar cane.
    • Reference

    • J Biol Chem. 2012 Jan 2;287(1):134-147.
    • Author

    • Pinto MF, Fensterseifer IC, Migliolo L, Sousa DA, de Capdville G, Arboleda-Valencia JW, Colgrave ML, Craik DJ, Magalhães BS, Dias SC, Franco OL.