• DRAMP ID

    • DRAMP04675
    • Peptide Name

    • Antimicrobial defensin peptide DRR230-c
    • Source

    • Pisum sativum (Garden pea)
    • Family

    • Not found
    • Gene

    • DRR230-c
    • Sequence

    • ALSFLFLFLFVAQEIVVTEANTCEHLADTYRGVCFTDASCDDHCKNKAHLISGTCHNFKC
    • Sequence Length

    • 60
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04675 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C296H448N78O88S6
    • Absent Amino Acids

    • MPW
    • Common Amino Acids

    • ACFLT
    • Mass

    • 6699.64
    • PI

    • 5.65
    • Basic Residues

    • 8
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 24
    • Net Charge

    • +1
    • Boman Index

    • -60.35
    • Hydrophobicity

    • 0.262
    • Aliphatic Index

    • 81.33
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 31.61
    • Polar Residues

    • 20

DRAMP04675

DRAMP04675 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Analysis of the DRR230 family of pea defensins: gene expression pattern and evidence of broad host-range antifungal activity.
    • Reference

    • Plant Sci. 2002, 163:855-864.
    • Author

    • Lai FM, DeLong C, Mei K, Wignes T, Fobert PR.
  • ·Literature 2
    • Title

    • Reference

    • Author