General Information

    • DRAMP ID

    • DRAMP18145

    • Peptide Name

    • Toxin OAIP 3

    • Source

    • Selenotypus plumipes (Australian featherleg tarantula)

    • Family

    • Belongs to the huwentoxin-1 family

    • Gene

    • Not found

    • Sequence

    • ECGGLMTRCDGKTTFCCSGMNCSPTWKWCVYAP

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18145 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C313H493N83O88S10

    • Absent Amino Acids

    • HQ

    • Common Amino Acids

    • GLC

    • Mass

    • 3637.24

    • PI

    • 7.85

    • Basic Residues

    • 7

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 21

    • Net Charge

    • +2

    • Boman Index

    • -4615

    • Hydrophobicity

    • 0.303

    • Aliphatic Index

    • 72

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 201.02

    • Polar Residues

    • 27

DRAMP18145

DRAMP18145 chydropathy plot

Comments Information

    • Function

    • Probable ion channel inhibitor. Shows insecticidal activity when injected into mealwormS.

Literature Information

  • ·Literature 1

    • Title

    • SVM-based prediction of propeptide cleavage sites in spider toxinsidentifies toxin innovation in an australian tarantula.

    • Reference

    • PLoS ONE 8:E66279-E66279 (2013)

    • Author

    • Wong E.S. , Hardy M. C. , Wood D., Bailey T., King G.F.