• DRAMP ID

    • DRAMP18146
    • Peptide Name

    • Toxin OAIP 2
    • Source

    • Selenotypus plumipes (Australian featherleg tarantula)
    • Family

    • Belongs to the huwentoxin-1 family
    • Gene

    • Not found
    • Sequence

    • DCLGQWASCEPKNSKCCPNYACTWKYPWCRYRA
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • Biological Activity

    • Insecticidal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18146 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C405H615N107O116S9
    • Absent Amino Acids

    • H
    • Common Amino Acids

    • ACESL
    • Mass

    • 3932.51
    • PI

    • 8.64
    • Basic Residues

    • 10
    • Acidic Residues

    • 9
    • Hydrophobic Residues

    • 26
    • Net Charge

    • +1
    • Boman Index

    • -10000
    • Hydrophobicity

    • -0.251
    • Aliphatic Index

    • 63.04
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 22835
    • Absorbance 280nm

    • 292.76
    • Polar Residues

    • 26

DRAMP18146

DRAMP18146 chydropathy plot
    • Function

    • Probable ion channel inhibitor. Shows insecticidal activity when injected into mealwormS.
  • ·Literature 1
    • Title

    • SVM-based prediction of propeptide cleavage sites in spider toxinsidentifies toxin innovation in an australian tarantula.
    • Reference

    • PLoS ONE 8:E66279-E66279 (2013)
    • Author

    • Wong E.S. , Hardy M. C. , Wood D., Bailey T., King G.F.