General Information

    • DRAMP ID

    • DRAMP18149

    • Peptide Name

    • U1-TRTX-Sp1a (Orally active insecticidal peptide 1; OAIP-1)

    • Source

    • Selenotypus plumipes (Australian featherleg tarantula)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DCGHLHDPCPNDRPGHRTCCIGLQCRYGKCLVRV

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • Helicoverpa armigera (LD50=104.2±0.6 pmol/g)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • beta sheet (7 strands; 13 residues)

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18149 helical wheel diagram

    • PDB ID

    • 2LL1 resolved by NMR

    • Predicted Structure

Physicochemical Information

    • Formula

    • C467H764N136O132S11

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • L

    • Mass

    • 3823.44

    • PI

    • 8.35

    • Basic Residues

    • 14

    • Acidic Residues

    • 13

    • Hydrophobic Residues

    • 32

    • Net Charge

    • +1

    • Boman Index

    • -10000

    • Hydrophobicity

    • 0.042

    • Aliphatic Index

    • 103.62

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 20.05

    • Polar Residues

    • 20

DRAMP18149

DRAMP18149 chydropathy plot

Comments Information

    • Function

    • Probable ion channel inhibitor. Shows insecticidal activity. Acts synergistically with the neonicotinoid insecticide imidacloprid. Is neither a repellent that repels insects nor an attractant that is preferentially consumed by insectS. Is very stable.

Literature Information

  • ·Literature 1

    • Title

    • SVM-based prediction of propeptide cleavage sites in spider toxinsidentifies toxin innovation in an australian tarantula.

    • Reference

    • PLoS ONE 8:E66279-E66279 (2013).

    • Author

    • Wong E.S. , Hardy M. C. , Wood D., Bailey T., King G.F.
  • ·Literature 2

    • Title

    • Isolation of an orally active insecticidal toxin from the venom of anAustralian tarantula.

    • Reference

    • PLoS ONE 8:E73136-E73136 (2013).

    • Author

    • Hardy M. C. , Daly N.L., Mobli M. , Morales R.A., King G.F.