General Information

    • DRAMP ID

    • DRAMP18252

    • Peptide Name

    • Carnolysin A2(Bacteriocin)

    • Source

    • Carnobacterium maltaromaticum C2

    • Family

    • Belongs to the lantibiotics family (Class I bacteriocin)

    • Gene

    • crnA2

    • Sequence

    • GDVMPESTPICAGFATLMSSIGLVKTIKGKC

    • Sequence Length

    • 31

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive(broad)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Altogether, there are six dehydrated ser or thr, and five thioether bonds in the two chains. For Carnolysin A1, residues 8, 10, and 25 are dehydrated; thioether bonds exist between residues 9, 13; 24,28; 41,45; residues 16, 21, 33, 36, are D-amino acids. For Carnolysin A2, residues 8, 16, and 20 are dehydrated; thioether bonds exist between 7, 11; 26, 31; residues 16 and 19 are D-amino acids, which is the first D-Abu in ribosomally synt

    • Helical Wheel Diagram

    • DRAMP18252 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18252.

Physicochemical Information

    • Formula

    • C137H232N34O42S4

    • Absent Amino Acids

    • HNQRWY

    • Common Amino Acids

    • G

    • Mass

    • 3155.79

    • PI

    • 8.03

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +1

    • Boman Index

    • 21

    • Hydrophobicity

    • 0.539

    • Aliphatic Index

    • 88.06

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 4.17

    • Polar Residues

    • 12

DRAMP18252

DRAMP18252 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of antimicrobial peptides from fish isolate Carnobacterium maltaromaticum C2: Carnobacteriocin X and carnolysins A1 and A2.

    • Reference

    • Int J Food Microbiol. 2014 Mar 3;173:81-8.

    • Author

    • Tulini FL, Lohans CT, Bordon KC, Zheng J, Arantes EC, Vederas JC, De Martinis EC.