• DRAMP ID

    • DRAMP18372
    • Peptide Name

    • mBD-2 (Murine beta-defensin 2a)
    • Source

    • Mus musculus
    • Family

    • Belongs to the beta-defensin family.
    • Gene

    • Not found
    • Sequence

    • CHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYM
    • Sequence Length

    • 34
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Anti-cancer
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18372 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18372.
    • Formula

    • C157H243N49O43S7
    • Absent Amino Acids

    • DLQW
    • Common Amino Acids

    • C
    • Mass

    • 3747.39
    • PI

    • 8.92
    • Basic Residues

    • 6
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +5
    • Boman Index

    • -6185
    • Hydrophobicity

    • -0.489
    • Aliphatic Index

    • 25.14
    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 98.68
    • Polar Residues

    • 16

DRAMP18372

DRAMP18372 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • A novel murine beta -defensin expressed in tongue, esophagus, and trachea Cancer cells.
    • Reference

    • J Biol Chem. 2000 Oct 27;275(43):33314-20.
    • Author

    • Jia HP, Wowk SA, Schutte BC, Lee SK, Vivado A, Tack BF, Bevins CL, McCray PB Jr.