General Information

    • DRAMP ID

    • DRAMP18372

    • Peptide Name

    • mBD-2 (Murine beta-defensin 2a)

    • Source

    • Mus musculus

    • Family

    • Belongs to the beta-defensin family.

    • Gene

    • Not found

    • Sequence

    • CHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYM

    • Sequence Length

    • 34

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Anti-cancer

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18372 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18372.

Physicochemical Information

    • Formula

    • C157H243N49O43S7

    • Absent Amino Acids

    • DLQW

    • Common Amino Acids

    • C

    • Mass

    • 3747.39

    • PI

    • 8.92

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +5

    • Boman Index

    • -6185

    • Hydrophobicity

    • -0.489

    • Aliphatic Index

    • 25.14

    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 98.68

    • Polar Residues

    • 16

DRAMP18372

DRAMP18372 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A novel murine beta -defensin expressed in tongue, esophagus, and trachea Cancer cells.

    • Reference

    • J Biol Chem. 2000 Oct 27;275(43):33314-20.

    • Author

    • Jia HP, Wowk SA, Schutte BC, Lee SK, Vivado A, Tack BF, Bevins CL, McCray PB Jr.