• DRAMP ID

    • DRAMP18373
    • Peptide Name

    • mBD-6 (Murine beta-defensin 6)
    • Source

    • Mus musculus
    • Family

    • Belongs to the beta-defensin family.
    • Gene

    • Not found
    • Sequence

    • CMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK
    • Sequence Length

    • 33
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: E. coli.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Serum or Protease Type

    • Not available
    • Stability Data

    • Not available
    • Assay

    • Not available
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18373 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18373.
    • Formula

    • C144H236N56O40S7
    • Absent Amino Acids

    • ADETVW
    • Common Amino Acids

    • G
    • Mass

    • 3616.23
    • PI

    • 9.69
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 3
    • Net Charge

    • +9
    • Boman Index

    • -8811
    • Hydrophobicity

    • -0.721
    • Aliphatic Index

    • 23.64
    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 58.28
    • Polar Residues

    • 18

DRAMP18373

DRAMP18373 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • A novel mouse beta-defensin, mBD-6, predominantly expressed in skeletal muscle.
    • Reference

    • J Biol Chem. 2001 Aug 24;276(34):31510-4
    • Author

    • Yamaguchi Y, Fukuhara S, Nagase T, Tomita T, Hitomi S, Kimura S, Kurihara H, Ouchi Y.