General Information

    • DRAMP ID

    • DRAMP18377

    • Peptide Name

    • Sphistin (histone-derived, Crustaceans, arthropods, invertebrates, animals)

    • Source

    • haemolymphs, Scylla paramamosain

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK

    • Sequence Length

    • 38

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Active against G+ bacteria (S. aureus, C. glutamicum, B. subtilis, M. lysodeikticus, M. luteus) and G- bacteria (S. flexneri, P. stutzeri, and P. fluorescens) (MIC < 1.5 uM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18377 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18377.

Physicochemical Information

    • Formula

    • C170H293N61O45S

    • Absent Amino Acids

    • CENTWY

    • Common Amino Acids

    • A

    • Mass

    • 3943.64

    • PI

    • 12.02

    • Basic Residues

    • 12

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +11

    • Boman Index

    • -8028

    • Hydrophobicity

    • -0.616

    • Aliphatic Index

    • 64.47

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 9

DRAMP18377

DRAMP18377 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Mechanism study on a new antimicrobial peptide Sphistin derived from the N-terminus of crab histone H2A identified in haemolymphs of Scylla paramamosain.

    • Reference

    • Fish Shellfish Immunol. 2015 Dec;47(2):833-46.

    • Author

    • Chen B, Fan DQ, Zhu KX, Shan ZG, Chen FY, Hou L, Cai L, Wang KJ.