General Information

    • DRAMP ID

    • DRAMP18379

    • Peptide Name

    • Acipensin 2 (Ac2)

    • Source

    • Leukocytes; the Russian Sturgeon, Acipenser gueldenstaedtii

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLR

    • Sequence Length

    • 35

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • Active against E. coli ML35p (MIC 0.3 uM), L. monocytogenes EGD (MIC 1.0 uM), MRSA ATCC 33591 (MIC 0.6 uM), C. albicans 820 (MIC 0.9 uM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18379 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18379.

Physicochemical Information

    • Formula

    • C160H281N63O41

    • Absent Amino Acids

    • CDEIMNWY

    • Common Amino Acids

    • R

    • Mass

    • 3761.4

    • PI

    • 12.78

    • Basic Residues

    • 12

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +12

    • Boman Index

    • -11348

    • Hydrophobicity

    • -0.883

    • Aliphatic Index

    • 59.72

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 11

DRAMP18379

DRAMP18379 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Acipensins - Novel Antimicrobial Peptides from Leukocytes of the Russian Sturgeon Acipenser gueldenstaedtii.

    • Reference

    • Acta Naturae. 2014 Oct;6(4):99-109.

    • Author

    • Shamova OV, Orlov DS, Balandin SV, Shramova EI, Tsvetkova EV, Panteleev PV, Leonova YF, Tagaev AA, Kokryakov VN, Ovchinnikova TV.